PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g48525.2.p
Common NameBRADI_1g48525, LOC100822397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 349aa    MW: 39372.5 Da    PI: 6.6071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g48525.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-1866112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT eEd +lv++v+q+G + W+ Ia++++ gR +kqc++rw+++l
  Bradi1g48525.2.p  66 KGQWTLEEDRKLVKLVEQFGLRKWSQIAQMLP-GRVGKQCRERWHNHL 112
                       799*****************************.*************97 PP

2Myb_DNA-binding52.51.1e-16118160145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++ W++eEd +l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Bradi1g48525.2.p 118 KDTWSEEEDMILIQTHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 160
                       679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.21461116IPR017930Myb domain
SuperFamilySSF466894.84E-3263159IPR009057Homeodomain-like
SMARTSM007172.4E-1665114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2967120IPR009057Homeodomain-like
CDDcd001672.21E-1569112No hitNo description
PfamPF139215.0E-2069127No hitNo description
PROSITE profilePS5129420.682117167IPR017930Myb domain
SMARTSM007173.6E-16117165IPR001005SANT/Myb domain
CDDcd001671.55E-12120163No hitNo description
Gene3DG3DSA:1.10.10.601.2E-21121165IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MNKAAVDASS IIHNSESHLP LLMPKIEVSH LIESGLRSYK TYEMSSRFIP RKKSSSKALK  60
KTNVVKGQWT LEEDRKLVKL VEQFGLRKWS QIAQMLPGRV GKQCRERWHN HLRPNIKKDT  120
WSEEEDMILI QTHKEVGNKW AEIAKRLPGR TENSIKNHWN ATKRRQFARR RTRSSSKNPK  180
SGTLLQSYIK SLGIGCSKVI APLDPKEPPL SPSSPPTPTE NLVDVNDNLL ESNSSNRIAS  240
QGIFSTDDIQ TYSCEEILVP MCDDFSDMCD GLFDAKEEAQ YQVYNIDDDV DMDSIFKHID  300
YAIKIDHGID MDMTWDDNAL INIESESSPL VTPIGPAEIK TEGGDGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-45641672105C-Myb DNA-Binding Domain
1mse_C3e-45641672105C-Myb DNA-Binding Domain
1gv2_A3e-45641672105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228004.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0Q3L8L60.0A0A0Q3L8L6_BRADI; Uncharacterized protein
STRINGBGIOSGA022369-PA1e-149(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-64myb domain protein 98